"useCountToKudo" : "false", "eventActions" : [ $('#vodafone-community-header .lia-search-input-wrapper').hide(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" "event" : "unapproveMessage", Da mein Guthaben meines Vodafone Kontos am Handy aufgebraucht war habe ich, nicht zum ersten Mal, mir eine Aufladekarte gekauft. "selector" : "#messageview_0", "event" : "MessagesWidgetEditAnswerForm", } "action" : "rerender" $(this).removeAttr('href'); "kudosable" : "true", ] $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { "kudosable" : "true", Mit der Direktaufladung können Sie noch schneller und einfacher Vodafone aufladen, denn Sie sparen sich den Umweg über einem Aufladecode, denn das Guthaben wird direkt auf die angegebene Vodafone Rufnummer geladen. "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); event.stopPropagation(); { } ] "message" : "1979178", ], LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mH4KG58526KjhN0C6Di8v6zn7mP4jFuMJiXcm__lyrM. "action" : "rerender" //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); { { ] Dann lad sie kostenlos bei Google Play oder im App Store herunter. "disableLinks" : "false", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "componentId" : "forums.widget.message-view", "selector" : "#messageview_0", "event" : "ProductAnswerComment", $(this).removeClass('active'); "action" : "pulsate" "context" : "envParam:quiltName,expandedQuiltName", ] "actions" : [ } } "context" : "envParam:entity", if ( key == neededkeys[0] ) { "context" : "", "context" : "envParam:feedbackData", "context" : "lia-deleted-state", "actions" : [ Geben Sie die Zeichen in Ihr Telefon ein und bestätigen Sie mit der grünen Taste "Wählen". count = 0; "context" : "", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":358,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKAFRWDlABBRgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVQV1AMUAYDXxQGW1VSSQFWVwZIDgMKAU8EUlAMA1FRUVRXDAFAThUPVn1bVgB\/AhsIQCNFB11aQm0mVwpVawNAG0ZeUGZXFkIwC2MXB0UdFwkWYSB6I3pmQgtTRHNhe39FWwNKQQMFUhcVZHx3N3NGTV0SC1RKXFcJDUV6L3R7NkIIRkhO"}. ] "action" : "rerender" "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/61825","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bqH7HHQ_mUPSBdSyU4F_WLzQJ0LbIGkSb2svVloY6pY. } { Execute whatever should happen when entering the right sequence "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "kudosable" : "true", "parameters" : { Was kann ich tun? "action" : "rerender" "action" : "pulsate" // Oops. "disableLinks" : "false", } // console.log(key); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" window.location.replace('/t5/user/userloginpage'); Halte deinen Guthaben-Code für die Eingabe bereit. } "initiatorDataMatcher" : "data-lia-message-uid" ] "actions" : [ ] "action" : "pulsate" { { } { } return; ] }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); }, "displaySubject" : "true", { "action" : "rerender" logmein: [76, 79, 71, 77, 69, 73, 78], "forceSearchRequestParameterForBlurbBuilder" : "false", Gib in Netzen mit CallBack *111*22922# ein. }, { } "event" : "ProductAnswer", element.siblings('li').find('ul').slideUp(); "action" : "rerender" Habe mich heute registriert, alles hat geklappt, nur ich kann kein Guthaben aufladen ! "context" : "", // Oops. }, Mit dem so aufge­lade­nen Guthaben kannst Du gle­ich im Play Store einkaufen. "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); if ( neededkeys[count] == key ) { { Wie üblich können Sie bei Vodafone auch Beträge von 15 beziehungsweise 25 Euro aufladen. "context" : "envParam:quiltName", LITHIUM.AjaxSupport.ComponentEvents.set({ Denn Vodafone konkretisiert folgend, dass nach 90 Tagen Nichtnutzung der Callya-Vertrag gekündigt werden kann. } kann ich also vodafone guthaben aufladen für lyca mobile? LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); element.siblings('li').find('li').removeClass('active'); watching = true; LITHIUM.AjaxSupport.useTickets = false; } ] }); .attr('aria-expanded','false'); } Mit einer weiteren Aufladung kann das Verfallsdatum wieder um ein Jahr verlängert werden. "actions" : [ "context" : "", "actions" : [ } Deine Karte können wir innerhalb von 90 Tagen wieder aktivieren. "event" : "editProductMessage", "initiatorBinding" : true, "actions" : [ "action" : "rerender" "kudosLinksDisabled" : "false", Steht Dir kein Internet zur Verfügung, so kannst Du die Abfrage auch anhand eines Tastencodes oder per Anruf ausführen. { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }); { "event" : "MessagesWidgetMessageEdit", "actions" : [ "actions" : [ } } ] "actions" : [ "initiatorBinding" : true, } } LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '7H1Lu1nvg_ofx4cW0yyqSep67tUg4YfpbefeXy5AUhw. Doch dank der Internet-Aufladung sollte es Ihnen auch gelingen, Ihr Vodafone-Guthaben von zu Hause oder unterwegs aus aufzuladen, wenn mal kein … "componentId" : "forums.widget.message-view", } var clickedDomElement = $(this); "actions" : [ "action" : "rerender" B. PayPal. $(event.data.selector).removeClass('cssmenu-open'); Deine E-Mail-Adresse wird nicht veröffentlicht. } "actions" : [ "displaySubject" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "initiatorBinding" : true, "closeEvent" : "LITHIUM:lightboxCloseEvent", }, "dialogContentCssClass" : "lia-panel-dialog-content", "linkDisabled" : "false" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "event" : "addMessageUserEmailSubscription", { - So geht`s bei Prepaid-Handys, HELPSTER - Anleitungen Schritt für Schritt. { }; "actions" : [ { { { } }, Innerhalb von 30 Sekunden können Sie Ihre Vodafone Guthaben aufladen und weiter telefonieren oder weiter surfen. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1979172 .lia-rating-control-passive', '#form'); { es erscheinen immerwieder probleme etc. // We made it! "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", { ist eine häufig gestellte Frage, gerade wenn es um dringende Anrufe geht. LITHIUM.Dialog.options['-1950577755'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "context" : "", ;(function($) { "context" : "", } { "event" : "ProductAnswerComment", { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, Vodafone CallYa: Aufladen per Kontoserver oder über das Internet Bild: teltarif.de, Vodafone Per inter­natio­nalem Roaming kann auch die Prepaid-Karte in zahl­reichen Ländern genutzt werden. ] } })(LITHIUM.jQuery); if ( neededkeys[count] == key ) { { "event" : "editProductMessage", } var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { "revokeMode" : "true", }, Du zahlst den Standardpreis für Anrufe ins deutsche Vodafone-Netz. var key = e.keyCode; // console.log('watching: ' + key); "eventActions" : [ "context" : "envParam:quiltName", "; "action" : "rerender" $(document).keydown(function(e) { $('div[class*="-menu-btn"]').removeClass('active'); return; }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", Das klingt erstmal gut, doch der Teufel steckt im Detail. ] } Diese Seite teilen. Hier ist ebenfalls die Einrichtung einer automatischen Aufladung möglich. "event" : "addThreadUserEmailSubscription", "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_65b50b2b75783d', 'enableAutoComplete', '#ajaxfeedback_65b50b2b75783d_0', 'LITHIUM:ajaxError', {}, 'OWFhD3H9sdaz--UfQgCGqI34y07IJdjfUkqzwyim1NU. //$('#lia-body').addClass('lia-window-scroll'); LITHIUM.Loader.runJsAttached(); Weitere Infos findest Du auf unserer … ] Vodafone-CallNow Ruf den CallYa KontoServer an. ] "actions" : [ "event" : "RevokeSolutionAction", Vodafon macht es Ihnen …, Beschäftigungsmöglichkeiten bei Krankheit, Vodafone CallYa aufladen - welche Möglichkeiten es gibt, Vodafone Prepaid-Karte freischalten - so gelingt's, ProSieben Internet Stick aufladen - so funktioniert es, Übersicht: Alles zum Thema Mobilfunkvertrag, Vodafone: Aufladen per PayPal - so geht's, Vodafone SIM-Karte freischalten - Anleitung, Wie kann man Guthaben schicken? } "actions" : [ }, "useSimpleView" : "false", "displayStyle" : "horizontal", "dialogKey" : "dialogKey" } { "displayStyle" : "horizontal", }); "action" : "rerender" } "buttonDialogCloseAlt" : "Schließen", Nun können Sie entscheiden, wie hoch der Aufladebetrag sein soll: Wählen Sie die 1, sind es 15€, bei 2 sind es 25€, bei 3 sind es 50€, die auf Ihr Konto gebucht werden und sofort zur Verfügung stehen. }, "event" : "expandMessage", ] ] { "event" : "ProductMessageEdit", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65b50b2c0ee536', 'disableAutoComplete', '#ajaxfeedback_65b50b2b75783d_0', 'LITHIUM:ajaxError', {}, 'ENnmuGNwUGO-ysOO5bF36Y5QJUhNnxgjAS6MX9tBWro. { Bist du sicher, dass du fortfahren möchtest? { "actions" : [ { "selector" : "#messageview", { "actions" : [ { "actions" : [ LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { { "event" : "approveMessage", "selector" : "#kudosButtonV2", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { }, { "event" : "removeThreadUserEmailSubscription", } ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_65b50b2b75783d_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61825&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", Und so geht's: Informier Deinen jetzigen Mobilfunk-Anbieter, dass Du Deine Handy-Nummer zu uns mitnehmen möchtest. }, } else { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); { "event" : "removeMessageUserEmailSubscription", "actions" : [ ] ] Bestätigung des SEPA-Lastschriftmandats hinterlegen. Um dein Guthaben ganz einfach automatisch per Bankeinzug aufladen zu können, musst du das SEPA-Lastschriftmandat bestätigen. } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "action" : "rerender" "action" : "rerender" "action" : "rerender" $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "}); "event" : "MessagesWidgetAnswerForm", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "useTruncatedSubject" : "true", ] ] ] var key = e.keyCode; { $('#vodafone-community-header .lia-search-input-wrapper').hide(); { } "actions" : [ "context" : "", // just for convenience, you need a login anyways... ] Wie kann ich mein Vodafone Guthaben aufladen? } LITHIUM.Dialog.options['-1828423795'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ;(function($) { ] "context" : "", "parameters" : { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] $(this).next().toggle(); }, { "kudosable" : "true", "event" : "MessagesWidgetEditAction", // --> { Du bekommst jew­eils einen Code. Ihre individuelle Bandbreite hängt unter anderem von Ihrem Standort und der Anzahl gleichzeitiger Nutzer in Ihrer Funkzelle ab. "context" : "", "useSimpleView" : "false", if ( !watching ) { "event" : "editProductMessage", } "showCountOnly" : "false", { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); createStorage("true"); "actions" : [ } "action" : "rerender" }, Wenn Du mit otelo telefonierst, bist Du daher im D2 Netz unterwegs.. Aber um die Prepaid-Karte von otelo nutzen zu können, musst du die Sim-Karte auch regelmäßig mit Guthaben aufladen.. Wie das funktioniert, und wie du das Guthaben abfragen, übertragen etc. Meldet ihr euch kostenlos bei my paysafecard an, könnt ihr euer Paysafecard-Guthaben aufladen und unter einem Account sammeln. Ich kann meine Prepaid-Karte nicht aufladen. { Achtung: Es kann vorkommen, dass die Emails im Spam-Ordner landen. var count = 0; { { "linkDisabled" : "false" $(this).next().toggle(); { "context" : "", "event" : "markAsSpamWithoutRedirect", Wie Sie Ihr Vodafone Guthaben abfragen können Nutzen Sie den Prepaid Tarif von Vodafone CallYa können Sie ganz leicht und auf verschiedenen Wegen Ihr aktuelles Guthaben abfragen. "actions" : [ ] } "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_65b50b2b75783d","tooltipContentSelector":"#link_65b50b2b75783d_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_65b50b2b75783d_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); }, { } "parameters" : { "context" : "lia-deleted-state", "disableLinks" : "false", "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } $('.js-close-header-announcement').on('click', clickHandler); } "event" : "MessagesWidgetAnswerForm", "useTruncatedSubject" : "true",